PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01363.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 485aa    MW: 54349.2 Da    PI: 5.0312
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01363.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.11.2e-173177148
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             l+pGfrFhPtdeelv++yLk+kv gk++++ ++i ++diyk+ePwdL 
  Rsa1.0_01363.1_g00002.1 31 LAPGFRFHPTDEELVSYYLKRKVLGKPVRF-DAIGDADIYKYEPWDLA 77
                             579************************999.99**************7 PP

2NAM94.22.1e-2912820550128
                      NAM  50 kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              ++k++++ew+f++  dkky +g r nr+t+ gyWkatg+d+e+ + + +l g+kktLvf++grap+g +t+Wvmheyrl
  Rsa1.0_01363.1_g00002.1 128 RLKTRDQEWFFYCALDKKYGNGARMNRSTNIGYWKATGRDREIRR-DVQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 205
                              5678999*************************************9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-182280IPR003441NAC domain
PROSITE profilePS5100548.51231229IPR003441NAC domain
PfamPF023651.0E-2433205IPR003441NAC domain
SuperFamilySSF1019412.75E-34124230IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MGPDSVAAVE SSPSSSATAP LSTAAVAATA LAPGFRFHPT DEELVSYYLK RKVLGKPVRF  60
DAIGDADIYK YEPWDLAGNE VCSCCYVFGY LKVLSLTPCV FLIPYGFLAK LVLPLWFASV  120
SGHEMFSRLK TRDQEWFFYC ALDKKYGNGA RMNRSTNIGY WKATGRDREI RRDVQLLGMK  180
KTLVFHSGRA PDGLRTNWVM HEYRLLDYET ESNGNLVQDA YVLVKVFHKN NIGPPCGNRY  240
APFMEEEWAD DGVALIPGVV RAEPLPLPNG NHQMDQSESK ELININEPPR EVTPMDIEVN  300
HQNQQLDNAL KPQENNNSNN NHCDEDEKAL KRENAEVDER PPPACAPSPL LQYKRRRQNE  360
SNSKDSSRTT TQDHSSSTAT TLIPSSAAAA TSTAISALLE FSLMDISEKK ENTIASPPTS  420
LPSNEEELND LKKEIHEMSV ERETFKLEMM SAEAMISILQ SRIDALRDEN DELKKMNSDK  480
GQAML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D8e-362323112170NAC domain-containing protein 19
3swp_C8e-362323112170NAC domain-containing protein 19
3swp_B8e-362323112170NAC domain-containing protein 19
3swp_A8e-362323112170NAC domain-containing protein 19
3swm_D8e-362323112170NAC domain-containing protein 19
3swm_C8e-362323112170NAC domain-containing protein 19
3swm_B8e-362323112170NAC domain-containing protein 19
3swm_A8e-362323112170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667521e-145KC966752.1 Brassica napus NAC transcription factor 50 (NAC50.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750306.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
TrEMBLA0A078F5F00.0A0A078F5F0_BRANA; BnaA05g28370D protein
STRINGBra029844.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.10.0NAC domain containing protein 50